PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109898.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 319aa    MW: 35307.7 Da    PI: 7.1183
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109898.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.8e-4391081100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk++rrkC+++Cv+apyfp +qp+kf nvhk+FGasnv+kll++l+ ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l+
  XP_010109898.1   9 PCAACKIQRRKCTQECVFAPYFPPDQPQKFCNVHKVFGASNVSKLLQELSASQREDAVNSLAYEAEARLRDPVYGCVGLISVLQHKLRQVQNDLN 103
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k+e
  XP_010109898.1 104 NAKKE 108
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9938109IPR004883Lateral organ boundaries, LOB
PfamPF031957.1E-439106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MASSSSSSPC AACKIQRRKC TQECVFAPYF PPDQPQKFCN VHKVFGASNV SKLLQELSAS  60
QREDAVNSLA YEAEARLRDP VYGCVGLISV LQHKLRQVQN DLNNAKKELA SYIGPHAAAS  120
LNLSLFQPPP PPPLPPYNNL HQHHQPPFFP QPLMAIPKGA SSSSSLPPAG HEIVLNIDPH  180
QQQQQQHFFE AQQLAAAMAA REQQELLRIS LEQKLNQPQE FLASSSHGFN NQNMSGPSSN  240
TISPTLALGS SFDNSNYHVN QPQQSEHHNL HHHQLLREQL MLGQAPQPEV AQQVLHQQQT  300
QIMLQKLESE ESKSVGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109898.10.0hypothetical protein L484_013233
TrEMBLW9SE870.0W9SE87_9R
STRINGGLYMA11G06210.21e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-63ASYMMETRIC LEAVES 2-like 1